SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007986 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007986
Domain Number 1 Region: 22-252
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.04e-66
Family Nuclear receptor ligand-binding domain 0.0000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007986   Gene: ENSOPRG00000008729   Transcript: ENSOPRT00000008725
Sequence length 268
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4252:49455:55707:1 gene:ENSOPRG00000008729 transcript:ENSOPRT00000008725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYHTSRYGSQCMQPNNIMG
IENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAP
LLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLXXXXACGL
SDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVG
KTPIETLIRDMLLSGSSFNWPYMSIQCS
Download sequence
Identical sequences ENSOPRP00000007986 ENSOPRP00000007986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]