SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008005 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008005
Domain Number 1 Region: 153-249
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.000000000000114
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0034
Further Details:      
 
Domain Number 2 Region: 369-425
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.000000000000459
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0045
Further Details:      
 
Domain Number 3 Region: 3-72,100-144
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0000000068
Family Methicillin resistance protein FemA probable tRNA-binding arm 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008005   Gene: ENSOPRG00000008743   Transcript: ENSOPRT00000008745
Sequence length 537
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4424:96989:138715:1 gene:ENSOPRG00000008743 transcript:ENSOPRT00000008745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLDLDLFRVDKGGDPALIRESQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLC
SKTIGEKMKKKEPVGDDESIPENVLNFDDVTADTLANLKVSQIKKVRLLIDEAILKCDTE
RLKLEAERFENLREIGNLLHPSVPISNDEDADNKVERIWGDCTVRKKYSHVDLVVMVDGF
EGEKGAVVAGSRGYFLKRVLVFLEQALIQYALRSLRSRGYTPIYTPFFMRKEVMQEVAQL
SQFDEELYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKR
KNNLPLSAQNKLEATSSLFSPKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXLQELIPFVKPAPIDQEPSKKQKKQHEGSKKKTGRDVILESQMQNLEVADA
Download sequence
Identical sequences ENSOPRP00000008005 ENSOPRP00000008005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]