SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008031 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000008031
Domain Number - Region: 1-99
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000126
Family Extended AAA-ATPase domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008031   Gene: ENSOPRG00000008783   Transcript: ENSOPRT00000008775
Sequence length 100
Comment pep:novel genescaffold:pika:GeneScaffold_4612:105353:106784:-1 gene:ENSOPRG00000008783 transcript:ENSOPRT00000008775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKTETTKDLGRALGTMVYVFNCSEQMDYKSCGNIYKGLAQTGAWACTKFNRISVKSLSGI
AVEVKCVQDAIRAKKKTFNFLGEVISLIPTVGIFITMNPG
Download sequence
Identical sequences ENSOPRP00000008031 ENSOPRP00000008031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]