SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008110 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008110
Domain Number 1 Region: 7-240
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 7.94e-76
Family Proteasome subunits 0.00000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008110   Gene: ENSOPRG00000008863   Transcript: ENSOPRT00000008859
Sequence length 241
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4424:333499:360772:-1 gene:ENSOPRG00000008863 transcript:ENSOPRT00000008859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLME
PSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLA
LQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSS
LQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQKFHMFTKEELEEVIKD
I
Download sequence
Identical sequences ENSOPRP00000008110 XP_004582031.1.84141 XP_006763034.1.95426 ENSOPRP00000008110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]