SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008185 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008185
Domain Number 1 Region: 579-927
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.7e-104
Family PDEase 0.00000327
Further Details:      
 
Domain Number 2 Region: 393-574
Classification Level Classification E-value
Superfamily GAF domain-like 1.55e-43
Family GAF domain 0.0000000951
Further Details:      
 
Domain Number 3 Region: 224-407
Classification Level Classification E-value
Superfamily GAF domain-like 8.59e-37
Family GAF domain 0.0000000203
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000008185
Domain Number - Region: 49-200
Classification Level Classification E-value
Superfamily GAF domain-like 0.000142
Family GAF domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008185   Gene: ENSOPRG00000008904   Transcript: ENSOPRT00000008940
Sequence length 938
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4740:117242:209946:-1 gene:ENSOPRG00000008904 transcript:ENSOPRT00000008940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQACGHSILCRSQQYPAARPAEPXXXXXXXXXXXXXXXXXXXXXXXXDALLNLGSVIDL
VGLQRAIKEALSAVLPRVETIYTYLLDQESRLVCEDPLHELPQEGKVREARSSRKRLTSN
VPGPGDLVGRPLATLTVSLAPYFVLVLPLVDKETGAVVAVILVHCGQLSDNEEWNLQAVE
KHTLVGLRRVRALQQREPSAAPGAIQNAQVEVVEDQKGGEAYTDQDQKILQLCGELYDLD
ASSLQLKVLQYLQQETQAARCCLLLVSEDNLQLSCKVIGDKVLGEEISFPLTTGRLGQVV
RDKKSIQWKDLTSDDVQQLQSMLGCEVQAMLCVPVISRATDQVVALACAFNKLGGALFTE
QDERVIQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITE
ARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYKIRIPADQGIAGHVATTGQILNIPD
AYAHPLFYRGGDDSTGFRTRNILCVHIKNENQEVIGVAELVNKINGPWFSKFDEDLATAF
SIYCGISIAHSLLYKVNEAQYRSHLANEMMMYHMVSDDEYTKLLHDGIQPVASIDSNFAN
FTYTPRSLPEDDTSMXXXXXXXXXXXXNNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAF
SVSHFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSE
GSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQK
MAEVGYDRTNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGN
RPMEMMDREKAYIPELQISFMEHIAMPIYKLLDLFPKAAELYDRVASNREHWTKVSHKFT
IRGLPSNNSLDFLDEEYEVAGLDGARAPVNGCCGLDTE
Download sequence
Identical sequences ENSOPRP00000008185 ENSOPRP00000008185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]