SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008457 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008457
Domain Number 1 Region: 2206-2299
Classification Level Classification E-value
Superfamily C-type lectin-like 4.34e-32
Family Link domain 0.0000959
Further Details:      
 
Domain Number 2 Region: 510-648
Classification Level Classification E-value
Superfamily FAS1 domain 7.72e-29
Family FAS1 domain 0.0016
Further Details:      
 
Domain Number 3 Region: 1560-1713
Classification Level Classification E-value
Superfamily FAS1 domain 3.66e-25
Family FAS1 domain 0.002
Further Details:      
 
Domain Number 4 Region: 966-1122
Classification Level Classification E-value
Superfamily FAS1 domain 1.23e-22
Family FAS1 domain 0.0044
Further Details:      
 
Domain Number 5 Region: 1714-1868
Classification Level Classification E-value
Superfamily FAS1 domain 1.96e-22
Family FAS1 domain 0.0046
Further Details:      
 
Domain Number 6 Region: 2297-2460
Classification Level Classification E-value
Superfamily FAS1 domain 9.16e-17
Family FAS1 domain 0.0081
Further Details:      
 
Domain Number 7 Region: 384-494
Classification Level Classification E-value
Superfamily FAS1 domain 5.76e-16
Family FAS1 domain 0.0067
Further Details:      
 
Domain Number 8 Region: 1130-1255
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000068
Family FAS1 domain 0.0053
Further Details:      
 
Domain Number 9 Region: 1453-1510
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000275
Family EGF-like domain of nidogen-1 0.054
Further Details:      
 
Domain Number 10 Region: 1501-1536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family EGF-type module 0.064
Further Details:      
 
Domain Number 11 Region: 1371-1497
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000832
Family Growth factor receptor domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000008457
Domain Number - Region: 874-912
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 904-962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00046
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 2010-2130
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000596
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number - Region: 2141-2174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0022
Family EGF-like domain of nidogen-1 0.063
Further Details:      
 
Domain Number - Region: 831-862
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family EGF-type module 0.045
Further Details:      
 
Domain Number - Region: 320-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0827
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 239-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0847
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008457   Gene: ENSOPRG00000009159   Transcript: ENSOPRT00000009243
Sequence length 2566
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1344:552182:579541:1 gene:ENSOPRG00000009159 transcript:ENSOPRT00000009243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGPQGHLLLCLLALCLAGPGFVKVQVRSKRCDVKTRFVTHVPCTSCAAIKNQLCPSDWT
PYFPEKISQGCRYEVRLGDSLMSMSGCSLECWKDVVQKACCPGYWGSQCYECPGGAETPC
NGHGTCLDGVAGNGTCVCQENFSGSACQECRDATHFGPNCLSVCSCVHGVCRHGPQGDGS
CLCFAGYTGPRCDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRNPQPSPC
SPLAQCSVSPMGQARCYCPENYHGDGTVCLPQDPCTTNFGGCPSNSTLCLYQKPGKAICS
CQPGLVNIKENPAAGCIALCHGRSCDQSATCQVTPNGKTSCACKEGEIGDGRACYGHLLH
EIQKANQKGLMILRLQVAISMLEHGCREILATSGPFTVLVPSITSQSSLFPRTMNTSIAQ
QLCRQYIIAGQHLLDDTRSTNTYRWWTLAGQEITISANRLVRYTYKYGSQSQQMGSIQKT
NYVAANGVFHMVSVQRWQPFAGLTVDSERTIGQILASKEVFSRFETILENCGLPSILEGP
GPFTVFAPSNEAVDSLRDGRLIYLFTAGLSKLQELVRYHIYNHGQLTVDKLLSKGRVLTM
ANQVLAVNISEEGRILLGPEGVPVRTVDLLAANGVIHLLEGILLPPTILPILPKHCNVEQ
HEIVVGSCVDCQALNTSTCPPNSVRLDMLPKECVYTHDPAGLNVMRKGCAQYCNQTVTKL
GCCRGFFGPECTQCPGGFSNPCYGKGSCNDGIQGNGACLCFPDYKGIACHICSNPNKHGD
KCQEDCGCVHGLCDNRPGSGGTCQHGTCAPGFSGRFCNESTMDCGPSGLSQLCHLHAHCV
SQAGVARCVCLDGFEGDGYSCVHSDPCSRPDRGGCSENAECIPGALGSYNCTCHKGWSGD
GRVCVAIDECELDARGGCHRDALCSYVGPGQSRCTCKLGFAGDGYKCSPIDPCRAGNGGC
HGLATCRAVGGGQRVCKCPAGFGGDGFSCYGDILRELEANAHFSVFYEWFKNASITLPAD
TQVTALVPSEAAIRRMSPEDRAFWLQPRRLPDLVRAHFLQGTLSEEELARLGGQNVATLS
SVKWEIRNASGRVWVQNASVDVADLLATNGVLHIVSQVLLPPRGVMQTGPGLLQQLASVP
AFGLFRDLLQHHQLVSQIEAATAYTIFVPTNHSLEAQGNSSNLDADTVRHHVILGEALSP
AALQRGGHRNSLLGPAHWLVFYNHTGQPEVNHVPLQGPVLQAPGRSLFGLSGVLTVDSSR
CLHSHDEAVREKCINCSRKYRCSQGYQLQDVPKRKCLYKSGRSVFQGCIYTCAKKIQVPD
CCPGFFGILCEPCPRGQGGVCSGHGQCEDRFLGDGQCRCWEGFHGTACEMCELGRYGPNC
TGVCDCAHGLCQEGLRGDGSCVCNVGWQGHRCDQKIINTQCPKLCDPNANCVQDLAGAPT
CVCAAGYSGNGSFCAEVDPCAHGHGGCSPHANCTKVAPGQRTCTCQDGYTGDGELCQEIN
SCLVHNGGCHVYADCIPTGPKQVSCSCREGYSGDGIQTCVPLDPCSQNNGGCSPYAICNS
TGDGQRTCTCDALHTVGDGFTCRTRVGLELLRDQQASFFSLHLLEYKELKGKGPFTIFVP
RADLMANLSQDELDRIRANRQLVFHYHVVGCRQLQSQDLLNEGYATALSGHTLRFSEREG
IIYLNDFARVVSSDNQAVNGVLHFIDRVLLPPEVLHWKPDTAPVPLRNISEAAESFGYKI
LSRLLRVSNVLPLLRAASHRPLTMLWPTDAALRALTPERQAWLDHEDHKDKLAAILRGHV
IRNMEATASDLPNLGPLRTLHGNLISFSCSQARPGELMVGNDEGRIVQRHLPFEGGLAYG
IDQLLEPPGLGARCDRFETRPLRTACSVCGLEPPCPAGSREQGSPENCWRYFPKFWPPPA
LHSWGPHSTWMRSSIWGPPPHSLARGCLRNCVTTTWVPSCCPGHYGSDCQACPGGPGSAC
SNHGMCLDGMSGSGRCVCQSGFAGIACEFCAPGFFGPNCQACRCTSHGHCDEGPGGSGSC
FCDEGWTGSRCEVQLKVEPVCTPPCAPHAVCREGNSCECSVGFVGNGSVCSAQCREGIDC
GEHASCRMEGVTFTCVCPPGYDGDGYDCWARNPCAGSHRGGCSEHANCVHTGPDTWHCEC
HAGYVGDGKQCLQESEPPVDRCLDLPPPCHVDAVCTDLHYQEKRAGVFHLQASSGPHSLT
FSEAEAACGAQGAVLASLPQLSAAQQLGFHLCLTGWLANGSAGHPVVFPADDCGNGQVGV
VSLGPRMNLSERWDAYCYRVQDVSCQCRAGLVGDGIDTCNGKLLDVLAATATFSTFYEML
LSYANASQRGFDFLSFLNDELTYKTLFVPLNEGFLGNVTLSGADLELHASNTTLLSTNAS
HGTLLPTYSGLSLLVGGLGLDNTSGVPMAPGAVVVSHVIMWDIIAVNGIIHTLASPLLAP
PQPEPVLAPEAAGVGAVGAVVAAGTLLGLVAGALYVRARGKSTGFGFSTFQAEDNADDDF
SPWQEGASPTLVSVPNPVFGSHDAFSEPDSLLDDDFPDTQRILAVQ
Download sequence
Identical sequences ENSOPRP00000008457 ENSOPRP00000008457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]