SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008547 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008547
Domain Number 1 Region: 117-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000226
Family Cripto EGF-like domain-like 0.00079
Further Details:      
 
Domain Number 2 Region: 80-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000171
Family EGF-type module 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008547   Gene: ENSOPRG00000009348   Transcript: ENSOPRT00000009340
Sequence length 191
Comment pep:known_by_projection scaffold:pika:scaffold_2105:112244:114844:1 gene:ENSOPRG00000009348 transcript:ENSOPRT00000009340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDRKMECLPARLILIVAISNTLEVGCVAGSDRHELAPSSPSLGDLALTMGSHRSQEKEPA
IHSRPPSSQFVPSMRIQDSRELNRSCCHNGGTCMLGLFCFCPPSFSGRNCEHDLRIRRSC
GSVPHDTWLPKRCSICKCWQGEMHCVSQAFLPGCGGHVTNEHLLASRTPGSSAHAGSTLM
LAGTCLAVSFY
Download sequence
Identical sequences ENSOPRP00000008547 ENSOPRP00000008547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]