SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008555 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008555
Domain Number 1 Region: 202-216,342-603
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-63
Family Nuclear receptor ligand-binding domain 0.0000685
Further Details:      
 
Domain Number 2 Region: 133-215
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.46e-32
Family Nuclear receptor 0.0000738
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008555   Gene: ENSOPRG00000009351   Transcript: ENSOPRT00000009348
Sequence length 615
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_132:200379:229660:1 gene:ENSOPRG00000009351 transcript:ENSOPRT00000009348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSPSPRIQIISTDSAVASPQRIQXXXXXXXXXXXXXXXXXXXIVTDQQTGQKIQIVTAV
DASGSPKQQFILTSPDGAGTGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVER
LLGKADVQRPQVVEYCVVCGDKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRSNQDCII
NKHHRNRCQFCRLKKCLEMGMKMESVQSERKPFDVQREKPSNCAASTEKIYIRKDLRSPL
IATPTFVADKDGARQTGLLDPGMLVNIQQPLIREDGTVVLATDSKAETSQGALGTLANVV
TSLANLSESLNNGDTSEIQPEDQSANEITRAFDTLAKALNTTDSSSPPSLADGVDTSGGG
SIHVISRDQSTPIIEVEGPLLSDTHVTFKLTMPSPMPEYLNVHYICESASRLLFLSMHWA
RSIPAFQALGQDCNTSLVRACWNELFTLGLAQCAQVMSLSTILAAIVNHLQNSIQEDKLS
GERIKQVMEHIWKLQEFCNSMARLDIDGYEYAYLKAIVLFSPDHPGLTSTSQIEKFQEKA
QMELQDYVQKTYSEDTYRLARILVRLPALRLMSSNITEELFFTGLIGNVSIDSIIPYILK
METAEYNGQITGAGL
Download sequence
Identical sequences ENSOPRP00000008555 ENSOPRP00000008555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]