SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008564 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008564
Domain Number 1 Region: 29-237,298-356
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 4.47e-27
Family D-aminoacid oxidase, N-terminal domain 0.00033
Further Details:      
 
Domain Number 2 Region: 224-310
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.49e-21
Family D-aminoacid oxidase-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008564   Gene: ENSOPRG00000009366   Transcript: ENSOPRT00000009357
Sequence length 369
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5091:1332:52371:-1 gene:ENSOPRG00000009366 transcript:ENSOPRT00000009357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRPSSPRKTSFGARADCGFQGRHCRDRNMDTIRVAVVGAGLAGLSTAVCLLALRPRCSVT
VLSDKHSPDTTSDVAAGVLIPHVFPETPIHKQKQWFRETFEHLSAVASSAEAADAGVHLV
SGXXXXXXXXXXXXXXXADVVLGFRRMTVAELKKFPQHVFGQAFTTLKCEGSAYLPWLET
RLKDGGGVILTRRVEDLWELHQNFDIVVNCSGLGSRELAGDSTVLPVRGQVLQVQAPWVK
HFIRDGSGLTYIYPGAFHVTLGGTRQEGDWSLAPDADISQDILSRCCSLEPSLRRAYNLK
VKVGLRPYRPGLRLQTELLSRDGRRLPVVHHYGHGAGGFSVHWGTALEAVRLVSECVQAL
PSPARSSKL
Download sequence
Identical sequences ENSOPRP00000008564 ENSOPRP00000008564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]