SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008966 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000008966
Domain Number - Region: 147-196
Classification Level Classification E-value
Superfamily PEP carboxykinase N-terminal domain 0.0785
Family PEP carboxykinase N-terminal domain 0.0082
Further Details:      
 
Domain Number - Region: 114-137
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.0926
Family Penicillin V acylase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008966   Gene: ENSOPRG00000009798   Transcript: ENSOPRT00000009810
Sequence length 346
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3898:160950:175455:-1 gene:ENSOPRG00000009798 transcript:ENSOPRT00000009810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLPCLLLLLAGGSVAASPPAPLFNVSLDVAPELRWLPVLRHYDPELVRAAVAQVIGSRV
PKWVLALIERSALELVRLLPPMFTAEIRGMSNFLNLSLADGLLVNLAYEYSAFCTSIVAQ
DSRGHIYHGRNLDYPFGNVLRKLTVDVQFLKNGQVAFRGTTFVGYVGLWTGQSPHKFTVS
GDERDRGWWWENLVAALFLRHSPISWLLRTTLSEAENFEAAVYRLAKTPLIADVYYIVGG
TSPREGVVITRNRGGPVDIWPLDPLNGAWFRVETNYDHWKPVPKRDDRRTPAIKALNATG
QANLNLETLFQVLSVVPVYNNYTVYTTVMSAAMPDKYMTRVRIQPK
Download sequence
Identical sequences ENSOPRP00000008966 ENSOPRP00000008966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]