SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009006 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009006
Domain Number 1 Region: 594-729
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-42
Family C-type lectin domain 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000009006
Domain Number - Region: 217-423
Classification Level Classification E-value
Superfamily Tropomyosin 0.000582
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009006   Gene: ENSOPRG00000009855   Transcript: ENSOPRT00000009855
Sequence length 737
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3262:32426:190841:-1 gene:ENSOPRG00000009855 transcript:ENSOPRT00000009855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFAEEEEVQSFGYKRFGIQEGTQCTKCKNNWALKFSIILLYILCALLTITVXXXXXXXVE
KMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGQKAISTNSELSTFRSDILDLRQQLR
EITEKTSKNKDTLEKLQASGDALVDRQSLLKETLENNSFLITTVNKTLQAYNGYVTNLQQ
DTSVLQGNLQNQMYSHNVVIMNLNNLNLTQVQQRNLITNLQRSVDDTSQAIQRIKNDFQN
LQQVFLQAKKDTDWLKEKVQSLQTLAANNSALAKANNDTLEDMNSQLNSFTGQMDNITTI
SQANEQNLKDLQDLHKDAENRTSLKFSQMEERFQLFETDIVNIISNISYTAHHLRTLTSN
LNEVRTTCTDTLTKHTDDLTSLNNTLANIRLDSVSLRMQQDMMRSRLDTEVANLSVIMEE
MKLVDSKHGQLIKNFTILQGPPGPRGPKGDRGSQGPPGPTGNKGQKGEKGEPGPPGPAGE
RGPVGPAGPPGERGSKGSKGSQGPKGSRGSPGKPGPQGASGDPGPPGPPGKDGLPGPQGP
PGFQGLQGTVGEPGVPGPRLPGLPGVPGMPGPKGLGPPGPSGAVAPLALQNEPTSTPEIN
GCPPHWKNFTDKCYYFSVEKEIFEDAKVFCEDKSSHLIFINTREEQRWINKQIVGRDSHW
IGLTDSEHENEWKWLDGTSPDYTNWKAGQPDNWDRGQGPGEDCAGLIYAGQWNDFQCDDI
NNFICEKDRESVLSSTV
Download sequence
Identical sequences ENSOPRP00000009006 ENSOPRP00000009006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]