SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009153 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009153
Domain Number 1 Region: 59-272
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.05e-74
Family Proteasome subunits 0.000000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009153   Gene: ENSOPRG00000010022   Transcript: ENSOPRT00000010018
Sequence length 276
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5122:2617:5619:-1 gene:ENSOPRG00000010022 transcript:ENSOPRT00000010018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLDVCGASGSCQAEWTFPAAGSKSGSDPGHYTFSLHSPELALPRGMQPTEFLKSVAQH
GDRRVQIEMAHGTTTLAFKFQHGVVVAVDSRASAGSYIATIRVNKVIEINPYLLGTMSGS
AADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMYQYRGMGLSMGSMICGWDKKG
PGLYYVDENGTRLSGTMFSTGSGNTYAYGVMDSGYRPDLSPEEAYDLGRRAIVHATHRDS
YSGGVVNMYHMKEDGWVKVESTDVSDLMYHYRETMQ
Download sequence
Identical sequences ENSOPRP00000009153 ENSOPRP00000009153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]