SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009184 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009184
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Globin-like 6.87e-49
Family Globins 0.000000903
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009184   Gene: ENSOPRG00000010063   Transcript: ENSOPRT00000010053
Sequence length 142
Comment pep:known_by_projection scaffold:pika:scaffold_26083:36900:37785:-1 gene:ENSOPRG00000010063 transcript:ENSOPRT00000010053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLTKSERTIIMSLWDKVSSQTEAIGTEALERLFSSYPQTKTYFPHFDLHPGSAQLRAHG
AKVAAAVGEAVRNVDNLPSALSKLSELHAYVLRVDPVNFKLLSHCLLISLAVRLPADFTA
ETHAAWDKFLCQVSAVLTEKYR
Download sequence
Identical sequences XP_004596642.1.84141 ENSOPRP00000009184 ENSOPRP00000009184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]