SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009194 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009194
Domain Number 1 Region: 496-734
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.3e-76
Family PDEase 0.0000042
Further Details:      
 
Domain Number 2 Region: 56-250
Classification Level Classification E-value
Superfamily GAF domain-like 2.4e-31
Family GAF domain 0.00044
Further Details:      
 
Domain Number 3 Region: 375-458
Classification Level Classification E-value
Superfamily GAF domain-like 3.71e-19
Family GAF domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000009194
Domain Number - Region: 237-288
Classification Level Classification E-value
Superfamily GAF domain-like 0.0218
Family GAF domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009194   Gene: ENSOPRG00000010042   Transcript: ENSOPRT00000010064
Sequence length 857
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3161:143268:200102:-1 gene:ENSOPRG00000010042 transcript:ENSOPRT00000010064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEVTAEEVEKFLDSNIGFAKQYCDLHFRAQVLSDLLGAKEPAVDLSNYHTLSSVEESEI
IFDLLRDFQENLQAETSTFNVMKKLCFLLQADRMSLFMYRTRNGVAELATRLFNVHKDAV
LEDCLVVPDSEIVFPLDMGVVGHVAHSKKLVNVPNTEEDEHFCDFVDNLTEYQTKNILAS
PIMNGKDVVAVIMAVNKVEGTHFTKKDEEILLKYLNFANLIMKVFHLSYLHNCETRRGQI
LLWSGSKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLLDMTKQKEFFDVWPVLMGEAP
PYSGPRTPDGREINFYKVIDYILHGKEDIKVIPXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXKEPLDESGWMIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEMDETLM
ESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPW
ECEEEELAEILQGELPDAEKYEINKFHFSDLPLTELELVKCGIQMYYELKVVEKFHIPQE
ALMRFMYSLSKGYRRITYHNWRHDFNVGQNMFSLLVTGKLKRYFTDLEALAMVTAAFCHD
IDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKTLLRDESLNIFQNLNRRQHEHAIH
MMDIAIIATDLALYFKKRTMFQKIVDQSKTYENAQEWTQYMMLEQTRKEIVMAMMMTACD
LSAITKPWEVQSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAAGNQ
VSPTPGGGGAAQAKFCC
Download sequence
Identical sequences ENSOPRP00000009194 ENSOPRP00000009194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]