SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009267 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009267
Domain Number 1 Region: 97-159
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.84e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009267   Gene: ENSOPRG00000010154   Transcript: ENSOPRT00000010141
Sequence length 215
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1154:411753:413722:-1 gene:ENSOPRG00000010154 transcript:ENSOPRT00000010141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLVVFHHHPVLHHEGYPFAAASAFAAAAAASRCAHEQNPYFHGWFIGHPEMSPPDYSMA
LSYSPEYASGAAGLDHSHYGGVPPGAGPPGLGGPRPVKRRGTANRKERRRTQSINSAFAE
LRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAAFKAEIKKTDVKEEKRK
KELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ
Download sequence
Identical sequences ENSOPRP00000009267 ENSOPRP00000009267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]