SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009323 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009323
Domain Number 1 Region: 302-599
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.64e-83
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000023
Further Details:      
 
Domain Number 2 Region: 601-706
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 9.67e-24
Family Anticodon-binding domain of Class II aaRS 0.0011
Further Details:      
 
Domain Number 3 Region: 62-123
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000218
Family TGS domain 0.0041
Further Details:      
 
Domain Number 4 Region: 123-170
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 0.000000000406
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000009323
Domain Number - Region: 260-299
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 0.00706
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009323   Gene: ENSOPRG00000010194   Transcript: ENSOPRT00000010203
Sequence length 718
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2640:230857:245993:1 gene:ENSOPRG00000010194 transcript:ENSOPRT00000010203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQCRKWRRLLRLPGFRACRLHTAAAPTPPSWLIERLGLFEELWTAQVKKLAVMAQKESR
TIKISLPGGQRVDAVAWSTTPYQLARRISPTLADTAVAAQVNGELYDLERPLEMDSDLTF
LTFDSPEGKAVFWHSSAHILGAAAEQFLGAVLCRGPSTEHGFYHDFFLGRXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXNSSSMWRSSRNPEMLQRVSGISFPTAELLRAWEAWREQAEL
RDHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVALIAEYTHRGFSEVKTPMLFSTK
LWEKSGHWEHYKEDMFALQPSDSDGSACSQSEHPARLPTDTLALKPMNCPAHCLMFAHRP
RSWRELPLRLADFGALHRAEASGAVGGLTRLRCFQQDDAHIFCTLDQLEAEIRGCLDFLR
SVYSILGFSFRLALSTRPSGFLGEPHLWDQAEQLLQQALEEFGEPWELNPGDGAFYGPKI
DVHLQDALRRPHQCGTIQLDFQLPLRFDLQYKGQAGTLERPVLIHRAVLGSVERLLGVLA
ESCGGKWPLWLSPCQVVVIPVGPEQEGYAREVQQTLQAAGLASDLDADPSLTLSRRVRRA
QLAHYNFQFVVGRKEQSSRTVSVRTRDNQQLGERDLRDATRRLLELQGARVPNAEEVF
Download sequence
Identical sequences ENSOPRP00000009323 ENSOPRP00000009323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]