SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009372 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009372
Domain Number 1 Region: 343-513
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.11e-45
Family Ribonuclease PH domain 1-like 0.0000381
Further Details:      
 
Domain Number 2 Region: 49-183
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-38
Family Ribonuclease PH domain 1-like 0.00013
Further Details:      
 
Domain Number 3 Region: 267-368
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.07e-23
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000712
Further Details:      
 
Domain Number 4 Region: 184-272
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.58e-23
Family Ribonuclease PH domain 2-like 0.0021
Further Details:      
 
Domain Number 5 Region: 495-581
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.08e-21
Family Ribonuclease PH domain 2-like 0.00024
Further Details:      
 
Domain Number 6 Region: 672-752
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000686
Family Cold shock DNA-binding domain-like 0.0039
Further Details:      
 
Domain Number 7 Region: 606-683
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000107
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009372   Gene: ENSOPRG00000010232   Transcript: ENSOPRT00000010259
Sequence length 783
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2385:4896:48661:-1 gene:ENSOPRG00000010232 transcript:ENSOPRT00000010259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAACRHCCSCLRLRPLGDVSLRLPGRDRALTHLQVRALWGGSGARAVAVDLGNRKLEISS
GKLARFADGCAVVQSGDTAVMVTAVSKTKPSPSQFMPLVVDYRQKAAAAGRIPTNYLRRE
IGSSDKEILTSRVIDRSIRPLFPAGYFYDTQVLCNLLAVDGINEPDVLAINGASVALSLS
DIPWNGPVGAVRIGIIDGECVVNPTRKEMSSSTLNLVVAGAPKSQIVMLEASAENILQQD
FCHAIKVGMKHTQQIIQGIQQLVREIGVSKRTPQKLFTPSPEIVKYAHTLAMEKLYAVFT
NYEHDKISRDEAVNKIRLDTEEQLKEKFPEVDPYEIIESFNVVAKEVFRSIILNEYKRCD
GRDLTSLRNISCEVDMFKTLHGSALFQRGQTQVLCTVTFDSLESSIKSDRITTAINGIKD
KNFMLHYEFPPYATNEIGKVTGTNRRELGHGALAEKALYPVIPKDFPFTIRVTSEVLESN
GSSSMASACGGSLALMDAGVPISSPVAGVAIGLVTKNNSEKGDIEDYRLLTDILGIEDYN
GDMDFKIAGTSKGITALQADIKLPGIPIKIVMEAIQQASXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXTVQVPLSKRAKFVGPGGYHLKKLQAETGVTISQVDEETFSIFAPTPSAMHEA
RDFIIEICKDDQEQQLEFGAVYTATITEIRDSGVMVKLYPNMTAVLLHNSQLDHRKIKHP
SALGLEVGQEIQVKYFGRDPADGRMRLSRKVLQSPATTVVKTLNDRGSIVMGEPISQSSN
SSQ
Download sequence
Identical sequences ENSOPRP00000009372 ENSOPRP00000009372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]