SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009529 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009529
Domain Number 1 Region: 168-218
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.55e-16
Family Myf domain 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000009529
Domain Number - Region: 63-96
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0235
Family Mitotic arrest deficient-like 1, Mad1 0.017
Further Details:      
 
Domain Number - Region: 274-326
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0454
Family Myf domain 0.0000698
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009529   Gene: ENSOPRG00000010434   Transcript: ENSOPRT00000010430
Sequence length 329
Comment pep:novel genescaffold:pika:GeneScaffold_3543:325:27344:1 gene:ENSOPRG00000010434 transcript:ENSOPRT00000010430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPAATPEPVHWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQA
TLREEKKLRVENAKLKKEIEELKKELIQAEIQNGVKQIPFLSDTPLQANSVACENVIPSA
PVTTASSGAKEQMKGGEEKKVKEKVEKKGEKKEKKQPAAGSADTKPIDVSRLDLRVGCII
TAKKHPDADSLYVEEVDVGESAPRTVVSGLVNHVPLDQXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEPDQELNPKKKIWEQIQPDLHTNDE
CVATYKGAPFEVKGKGVCRAQTMSNSGIK
Download sequence
Identical sequences ENSOPRP00000009529 ENSOPRP00000009529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]