SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009692 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000009692
Domain Number - Region: 121-171
Classification Level Classification E-value
Superfamily L domain-like 0.0031
Family Internalin LRR domain 0.054
Further Details:      
 
Domain Number - Region: 206-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00614
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 78-113,175-239
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0769
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009692   Gene: ENSOPRG00000010606   Transcript: ENSOPRT00000010611
Sequence length 275
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3390:51315:55022:1 gene:ENSOPRG00000010606 transcript:ENSOPRT00000010611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDASLPYQESNAVRPGRVGHARGREREALWGVASGLASSEGRRKRNMALHELGRRPAPVR
WAAALFLALGVERALALPEICSQCPGSVHNFSAVAAYCEQIPGLMLHARCCLNQEGTILG
LDLQNCSLKDPGPNITQAHTAVIIELQANPLQADLTNTFRGFTQLQTLVLPQDVNCPGGI
SAWNTVSSYTDNQTCQGQKNLCNSTQAPDTCPENGFCVPDGPGFSQCVCADGFHGYKCMR
QGEFPLLMFFGILGSTTLALSVLLWGTQRRKAKIS
Download sequence
Identical sequences ENSOPRP00000009692 ENSOPRP00000009692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]