SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009702 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009702
Domain Number 1 Region: 58-223
Classification Level Classification E-value
Superfamily C-type lectin-like 6.65e-48
Family C-type lectin domain 0.00000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009702   Gene: ENSOPRG00000010620   Transcript: ENSOPRT00000010621
Sequence length 223
Comment pep:novel genescaffold:pika:GeneScaffold_629:8339:25882:-1 gene:ENSOPRG00000010620 transcript:ENSOPRT00000010621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTDMFKATRERSLGPVGEASVYPEEDDLARRPRGTWSWKGCKVSAGHLRSHLSLVLQLLC
VLLCAVLLVQVLEVSKVPSSKTEEIHQDLMQLKAGLANLCRPCPWDWTFFQGHCYFFSKS
QRNWHDSVSACQDVGAQLVIVRSDEEQSFLQLNAKSRGPTWMGLSDLKKEGTWHWVDGSP
LMLSFTKFWNRGEPNDIGGEDCAEFRGDGWNDSLCNGLRFWVC
Download sequence
Identical sequences ENSOPRP00000009702 ENSOPRP00000009702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]