SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009754 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000009754
Domain Number - Region: 755-823
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0188
Family Single strand DNA-binding domain, SSB 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009754   Gene: ENSOPRG00000010663   Transcript: ENSOPRT00000010680
Sequence length 901
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3621:35680:407990:1 gene:ENSOPRG00000010663 transcript:ENSOPRT00000010680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGVRAGGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSSAE
ILEYSSDSGKEDELENTLSIDAESPHKQQLDLDAKSPAPVLSTPQRQTAKFFKTSENSAR
KKFLRGGLAERLNGLQNRERSTISLWRHQHVPYQRTLSGGQSSVLIVKILELHEECTIQV
ALCQQLGGPPTASPSQGVASGPGANLKVLFTKETAGYLRGRPQDIIHIFPPWQKLTVPNG
SCPIILNTYFCQKVVPKEDSEKIQEMHCLDTVPPRRNITLVQMYKIRNLTSNSPEIQVMC
SDVDPLGTGWTHGYKEAKQHLTFCASSRDSLLDMVESQGTSLSSGMPVRVVVQRVYALHG
RDSTWTQQGSSSGHTDLAGARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXTAGLFSLIDSLWPPAVPLKAPGHGQPYEEVKTHLPPPTFCYILTGHPNLGQI
DVIKEDSLSRLYQPPVPHCLREILQXXXXXXXXXXXXXXXXXXXXLKSLLLLEQREIWLL
VTDITLQATDERDPHVPKTLPVCVAPFCVLGPEVLEALTAAAPPNLLFRDALQDQGRIVC
VERTVLQLQQPLLCVASGAASCELSGPVVLDELDGLTPVNSICSVQGTVTAVDESTAFSW
PVCDRCGNGRLEQRPENGGTLSCGDCSRVVTSPVLRMHLQVFLDCPSRPQCRVKVKLLQS
SISSLLSSATCEDGSYEAKSVLGRELRLASCFVQSITGHPASVGLEEIEPRRAGGSSAEP
P
Download sequence
Identical sequences ENSOPRP00000009754 ENSOPRP00000009754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]