SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009798 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009798
Domain Number 1 Region: 54-181,212-329
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.02e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.06
Further Details:      
 
Domain Number 2 Region: 616-690
Classification Level Classification E-value
Superfamily EF-hand 2.54e-17
Family Calmodulin-like 0.02
Further Details:      
 
Domain Number 3 Region: 310-404
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000922
Family D-aminoacid oxidase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009798   Gene: ENSOPRG00000010713   Transcript: ENSOPRT00000010727
Sequence length 697
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1352:47920:197462:1 gene:ENSOPRG00000010713 transcript:ENSOPRT00000010727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFQKAVKGTVLVGGGALATVLGLSHFAHYRRKQVNLAYVEAAECLTEPVNREPPSREAQ
LLTLQNTSEFDILVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPIYKWWQLPYYWVGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVVSLLKKTDPETGKERVSGARCKDVLTGKEFDVRAKCVINATGPFTDSVRKM
DDKNAAAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTD
ITPHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNH
VVDISESGLITIAGGKWTTYRSMAEDTINAAIKTHNLKAGPSRXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXVAQHLAATYGDKAFEVAKMASVTGKRWPVVGVRLVSEFPYIEAEVKYE
IKEYARTDVDMISRRTRLPFLNQAAEEALPRIVELMGRKLNWNDYKQELETARKFLYYEM
GYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESINVQMDENT
LHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSR
Download sequence
Identical sequences ENSOPRP00000009798 ENSOPRP00000009798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]