SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009986 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009986
Domain Number 1 Region: 124-656
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.4e-125
Family Gamma-glutamyltranspeptidase-like 0.000000605
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009986   Gene: ENSOPRG00000010927   Transcript: ENSOPRT00000010934
Sequence length 662
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5034:249210:307147:-1 gene:ENSOPRG00000010927 transcript:ENSOPRT00000010934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAENEASQESALGAYSPVDYMSITSFPRLPEDEPAPAAPLRGRKDEDAFLGDPDTDPDS
FLKSARLQRLPSSSSEMGSQDGSPLRETRKDPFSAAAAECSCRQDGLTVIVTACLTFATG
VTVALVMQIYFGDPQIFQQGAVVTDAARCSSLGIKVLSQQGSSVDAAVAAALCLGIVAPH
NSGLGGGGVMLIHDIRRNESHLIDFRESAPGALREEALQRSWETKPGLLVGVPGMVKGLY
EAHQLYGRLPWSQVLAFAAAVAQDGFNVTHDLAQALAEQVPPNASERFLEMFLPSGHPPL
PGSLLRRPDLAEVLNALGTSGPAAFYAGGNLTLEMVAEVQHAGGVLTEEDFINYVALVEK
PVCGVYRGHLVLSPPPPHTGPALISALNILEGFNLTSLVPREQALHWVAETLKIALALAS
RLGDPVYDSTITESMDDMLSKVEATYLRGHINDSQAAPASLLPVYELDGAPTAAQVLVMG
PDDFIVAMVSSLNRPFGSGLITPSGILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPL
SFLLPTVVRPAKGLCGTYLALGANGAARGLSGLTQVLLNVLTLNRNLSDSLAQGRLHPDL
QSNLLQVDSEFTEEEIEFLEARGHHVEKVDVLSWVHGSRRTNNFIIGVKDPRSPDAAGAT
LP
Download sequence
Identical sequences ENSOPRP00000009986 ENSOPRP00000009986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]