SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010038 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010038
Domain Number 1 Region: 370-485
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.98e-38
Family Nuclear receptor ligand-binding domain 0.000000407
Further Details:      
 
Domain Number 2 Region: 135-210
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.32e-27
Family Nuclear receptor 0.0000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010038   Gene: ENSOPRG00000010997   Transcript: ENSOPRT00000010992
Sequence length 486
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_69:48857:90699:1 gene:ENSOPRG00000010997 transcript:ENSOPRT00000010992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMQFQGLENPVRISPHPSCTPPEFVTDMMSMKPAKXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXFYSQQPEEWYSPGIYELRRMPAETFYQGETEVADIPVTK
KPRMGVSAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCV
MDMYMRRKCQECRLRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQHADPTINDDTEG
QDLRQVTSTTKSCREKTELTPDQQNLLHYITDSYNKQRMPQEITNKIXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXISDEFITPMFSFYKSVGELKMTQEEYALLTAIVILSPDRQYIKDREAVEK
LQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLC
EIWDVQ
Download sequence
Identical sequences ENSOPRP00000010038 ENSOPRP00000010038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]