SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010086 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010086
Domain Number 1 Region: 4-183
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-33
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0091
Further Details:      
 
Domain Number 2 Region: 199-392
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000609
Family FAD/NAD-linked reductases, N-terminal and central domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010086   Gene: ENSOPRG00000011049   Transcript: ENSOPRT00000011045
Sequence length 395
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1456:121450:132297:1 gene:ENSOPRG00000011049 transcript:ENSOPRT00000011045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENVEDGRASIYQSVITNTSKEMSCFSDFPMPEDFPNLLHNSKLLEYFRIFAKKFDLLKYI
QFQTTVINVKRRPDFSSSGQWEVVTQSNNKEQSSVFDAVMVCSGHHILPNIPLKSFPGIE
KFKGQYFHSRQYKHPTGLEGKRILVIGIGNSASDIAVELSKNAAQVYISTRKGAWVMSRI
SEDGYPWDMVFHTRFNSMLRNVLPRVVVKWMMERQMNRWFNHENYGLVPENDRFSIFDAT
VVEAIDVIVFATGYTFAFPFLEESLVTIKENMVSLYKYMFPPQLEKSTLACIGLIQPLGS
IFPTVELQARWATRVFKGLCTLPPEGTMMADIIQRTEKRIDLFGESQSQKLQTNYVDYLD
ELALEIGAKPDILSFLFKDPKLAMKLYFGPCNSYQ
Download sequence
Identical sequences ENSOPRP00000010086 ENSOPRP00000010086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]