SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010168 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010168
Domain Number 1 Region: 98-279
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.94e-35
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000135
Further Details:      
 
Domain Number 2 Region: 443-545
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.06e-30
Family Ricin B-like 0.00000179
Further Details:      
 
Domain Number 3 Region: 321-415
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.000000000135
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010168   Gene: ENSOPRG00000011132   Transcript: ENSOPRT00000011133
Sequence length 552
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2545:19876:106799:1 gene:ENSOPRG00000011132 transcript:ENSOPRT00000011133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKKFAYLKVVLATSLIWVLMDMILLLYLSEHKCRRGLTEDXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCKTKVYPDNLPTTSVVIVFHN
EAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQR
SGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTF
EYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNN
RRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRHKLQCKPFSWYLENIYPDSQIPR
HYFSLGEXXXXXXXXXXXXXARENEKVGIFNCPGMGGNQVFSYTANKEIRTDDLCLDVSK
LNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCSGSRSQQ
WLLRNVTLPEIF
Download sequence
Identical sequences ENSOPRP00000010168 ENSOPRP00000010168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]