SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010202 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010202
Domain Number 1 Region: 1527-1630
Classification Level Classification E-value
Superfamily C-type lectin-like 7.85e-42
Family Endostatin 0.00000383
Further Details:      
 
Domain Number 2 Region: 408-561
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-23
Family Laminin G-like module 0.031
Further Details:      
 
Domain Number 3 Region: 287-359
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.000000000000196
Family Frizzled cysteine-rich domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010202   Gene: ENSOPRG00000011111   Transcript: ENSOPRT00000011172
Sequence length 1632
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4526:5:31543:1 gene:ENSOPRG00000011111 transcript:ENSOPRT00000011172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLMLTCCVPIAWAQLLNWIWATENVNPLSKWVPKSLGSPVEPTLGLTTHGDLGHGPTEPE
AASPAPADTSPDATLATSPGTTKEGNVAGVGAQILNVAASIRSFVQLWDEAAPTESAAGV
ATLATVAITDPLTLPRPPDDPQEHRDALGPSTSSDAPTTTANAVLAPTTPLTSSGQPQAS
SGVSPGRTALSSPPGGAPPWGSPQDLHSSRGPRPMAAAPRRQRSEQLGGGHRALCLLPLV
LGLPGVHVAPAARTPDLLASPALAAAPAFIGDGGGGPWVSHAANDSARCLPLPPALPMCS
HLVSGHTWLPNHLGHARGEEMQAAKQAWGGLLQPRCHPFLAWFFCLLLCTPNASLAPPPR
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSGDEVGLLQLLGEPPP
QQVTEVEDPDVGLAYVFGPDANSGQAAHYHFPSPFFRDFSLLFRIRPATTQAGVLFAITD
PAQAVVRLGVKVSEVQDDHQLISLLYTEPGTSPTRTAASFRLPAFVGQWLRFALSVDAGH
VALYVNCEEFQRVPFSRSAQSLPLXXXXXXXXXXXXXXXXXXXXGSIAELSVRGDPQLSP
QHCLDEEDDDDGGASGDFGSGLKENGELPMEGMGTSRKPSPPQPPAVTSPPLAEDSTIED
SRTEETEETTVATLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXGEPGFRGPPGPYGRPGHKGEIGFPGRPGRPGMNGLKGEKGEPGDVSLGFA
MRGPPGPPGPPGPPGPPGTPVYDSNVFAESSHPGPPGLPGLQGPPGPKGXXXXXXXXXXX
XQFPFDFLQLEAEMKGTKGDRGAPGQKGERGEPGAGGFFGSSVPGPPGPPGPQGYPGIPS
SKRDSIRGPPGPPGPRGPSCIVYETRQSPPGPPGPHGPPAIPSAYRQXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGPRT
PLPRGTDNEVAALQPPVVQLYEGNPHPRREHTHSTVRPWRADDILANPPYLPDPRPYPGA
PRHGSYTHLQPARPTASPDHIHQDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARAAG
LAGTFRAFLSSRLQDLYSIVRRSDRTGLPIVNLKDEELFPSWEALFSGTRGQLRPGARIF
SFDGRDVLRHPA
Download sequence
Identical sequences ENSOPRP00000010202 ENSOPRP00000010202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]