SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010230 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010230
Domain Number 1 Region: 40-189
Classification Level Classification E-value
Superfamily C-type lectin-like 1.38e-30
Family C-type lectin domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010230   Gene: ENSOPRG00000011213   Transcript: ENSOPRT00000011203
Sequence length 212
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3121:44112:95932:1 gene:ENSOPRG00000011213 transcript:ENSOPRT00000011203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRVVSLLQSALLCGHGTLPSLNSLVSGQKVCFADLRHPCYKMAYFHELSSRVSFQEARL
ACETEGGVLLSLGDEAEQKLIESMLQNLTKPGTGISDGDFWIGLWRNGEGQNSGACPDLY
QWSDGSSSQYRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICK
YEPEIIPTEPVEKPYLTNQPGDTQENVVVTEA
Download sequence
Identical sequences ENSOPRP00000010230 ENSOPRP00000010230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]