SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010250 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010250
Domain Number 1 Region: 170-420
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.91e-80
Family Eukaryotic proteases 0.00028
Further Details:      
 
Domain Number 2 Region: 38-166
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000000471
Family SEA domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010250   Gene: ENSOPRG00000011229   Transcript: ENSOPRT00000011225
Sequence length 421
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4760:35819:89848:-1 gene:ENSOPRG00000011229 transcript:ENSOPRT00000011225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMYRAIGFGTPRRNLQPWMIGLLAVLSLILVAVIIGLLVHFLFPGQKMEYYHGTFKMAHL
QNSNNSGINKMYQLKDLREMSKNMVSWVDAIFIDSTLNKHYIKNRVVRLTPEEDSVKADV
VMVFQFPSTGQRAVREKKVHNILKQKMRNVRALRIDPSSVDVKAMSSSTGELTVQACCGK
RVVPLIVNRIMSGDIAARAAWPWQASLQRDNIHQCGATLISNTWVITAAHCFKNNANPRQ
WTVSFGTTINPPLMKRNVKRIVVHERYRSPAREYDIAVVQFSPRVTFSDDIRRVCLPEAS
ASFRPNSTVYITGFGALYYGGESQNDLREARLKLISNDVCKQPQVYGNDIKFGMFCAGYL
EGIYDACRGDSGGPLVAKDLKDTWYLIGIVSWGDNCGQKNKPGVYTEVTYYRHWIASKTG
L
Download sequence
Identical sequences ENSOPRP00000010250 ENSOPRP00000010250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]