SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010259 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010259
Domain Number 1 Region: 762-1016
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.42e-89
Family Eukaryotic proteases 0.000000122
Further Details:      
 
Domain Number 2 Region: 671-772
Classification Level Classification E-value
Superfamily SRCR-like 9.16e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.019
Further Details:      
 
Domain Number 3 Region: 640-678
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000524
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 523-582
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000314
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000010259
Domain Number - Region: 59-92
Classification Level Classification E-value
Superfamily SEA domain 0.0275
Family SEA domain 0.021
Further Details:      
 
Domain Number - Region: 427-472
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0617
Family MAM domain 0.078
Further Details:      
 
Domain Number - Region: 225-258
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0882
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010259   Gene: ENSOPRG00000011224   Transcript: ENSOPRT00000011235
Sequence length 1017
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3121:112764:231149:-1 gene:ENSOPRG00000011224 transcript:ENSOPRT00000011235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKRNVASKHHDISTQEILFAALFVILTVICAGIIAVCWLAIDGSETDSVFEESHEARG
TFTITSGATYSPTLQDEESMDFKVLAFDLQQMXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXFDLFFAQWVSDENVKDELIRGIQANKSSQLTAYRIDLNSINITXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVCDGQFLLTESSGSFGA
DQHPNSSGSSVVCQWIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXYYMYGVNVYKFSINITSDQNTEKTIFQRQGNYGENWNYGQVTINETVEFKXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCEGPFELWEPNTTFSST
NFPDEYPNQAFCVWYLNAESGNILLHFQEFDLENIEDVDVRDVGEDDSLLLXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPCQEDSFQCENGECIPLVNLC
DGHPHCTDGSDEARCVRLINGTTNYDGLVQFRIQSVWHIACADNWTTQISNDVCQLLGLG
SENSSIPISYTGPGPFVKLSTSPSGSLTTTPSSQCSQDSLILLQCNRKLCGTKLVAQDDR
PRIVGGTDAREGAWPWVVALSYNGQLLCGASLVSNNWLVTAAHCVYGRNMEPTRWTAILG
LHMTSNQTSPHVVTQRLDEIVISPHYNERANDADIAMMHLEVQVNYTDYIQPICLPEENQ
IFPPGKNCSIAGWGRLLYQGVTADILQEAVVPLVSNEKCQQQMPEYNITENMMCAGYEEG
GVDTCQGDSGGPLMCQENNRWFLVGVTSFGYQCAQPNRPGVYVRATRFTEWIQSLLD
Download sequence
Identical sequences ENSOPRP00000010259 ENSOPRP00000010259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]