SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010320 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010320
Domain Number 1 Region: 41-335
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000513
Family Rhodopsin-like 0.024
Further Details:      
 
Domain Number 2 Region: 2-57
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00000536
Family Hormone receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010320   Gene: ENSOPRG00000011308   Transcript: ENSOPRT00000011307
Sequence length 368
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1737:608232:622510:1 gene:ENSOPRG00000011308 transcript:ENSOPRT00000011307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQGHVYRFCTAEGHWLHKDNSSLPWRDLSECEESRRGEKSSQEEQLLSLYIIYTVGYALS
FSALVIASAILLGFRHLHCTRNYIHLNLFASFILRALSVFIKDAALKWMYSTAAQRHQWD
GLLSYQDSLGCRLVFLLMQYCVAANYYWLLVEGVYLYTLLVFSVFSEQRVFRLYLSIGWG
FPLLFVIPWGVVKYLYEDEGXXXXXXXXXXXXXXXXXXXXXXXGNFLHLIRVIGIRVYKV
QDNLMSKTDFKCRLAKSTLTLIPLLGTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQG
LMVAILYCFINNEVRMEFRKSWERWRLEHLHIQRDSSMKPLKCPTSSMSSGATVGSSVYA
TTCQAACS
Download sequence
Identical sequences ENSOPRP00000010320 ENSOPRP00000010320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]