SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010322 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010322
Domain Number 1 Region: 21-158
Classification Level Classification E-value
Superfamily L domain-like 1.59e-36
Family Ngr ectodomain-like 0.0035
Further Details:      
 
Domain Number 2 Region: 302-367
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000000000115
Family Hormone receptor domain 0.005
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000010322
Domain Number - Region: 740-892,927-1019
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0165
Family Rhodopsin-like 0.017
Further Details:      
 
Domain Number - Region: 247-282
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0357
Family C2 set domains 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010322   Gene: ENSOPRG00000011298   Transcript: ENSOPRT00000011309
Sequence length 1219
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3056:58380:187466:-1 gene:ENSOPRG00000011298 transcript:ENSOPRT00000011309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKVVCSSLELSQVLPPDTLPNRTVTLILSNNKISELKNGSFSGLSLLERLDLRNNLISSI
DPGAFWGLSSLKRLDLTNNRIGCLNADIFRGLTNLVRLNLSGNLFSSLSQGTFDYLGSLR
SLEFQTEYLLCDCNILWMHRWVKERNVTVRDTRCVYPKALQAQPVTGVRQELLTCXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXALTISNIQAGSTGNWGCHVQTKRGNNTRTVDIVVLESSAQYXXXXXXXXXXXX
XXWPRTLAGITAYLQCTRNTHGSGIYPGSPQDERKAWRRCDRGGFWAEDDYSRCQYANDV
TRVLYMFNQMPLNLSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XLGDVMVDIASNIMLADERVLWLAQREAKACSRIVQCLQRIATYRLANGAHVYSTYSPNA
LEAYVIKAAGFTGVTCTVFQKVASSDRAGLSDYGRRDPDGNLDKQLSFKCNVSNTFSSLA
LKNTVVEASIQLPASLFSPKQKREVRPMDDSLYKLQLIAFRNGKLFPATGNSTNLADDGK
RRSVVTPVILTKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXLIRISLKSWHMLVNLCFHVFLTCVVFVGGITQTRNASVCQAVGIVLHYSTLATML
WVGVTARNIYKQVTRKAKRCQDPDEPPPPPRPMLRFYLIGGGIPIIVCGITAAANIKNYG
SRPNAPYCWMAWEPSLGAFYGPASFITFVNCMYFLSIFIQLKRHPERKYELKEPAEEQQR
LAANENGEVNHQDAMSLSLISTSALENEHTFHSQLLGVSLTLLLYVALWMFGALAVSLYY
PLDLVFSFFFGATCLSFSAFIMVHHCVNREDVRLAWVMTCCPGRSSYSVQVNVQPPSTSG
PHGEVPKCINSSAESSCTNKSASSFKNSSQGCKLTNLQAAAAQCHTNPLPLNSTPQLDNS
LTEHSMDNDIKMHVAPVDVQFRTNAHPGRHHKNRSKGHRASRLTVLREYAYDVPTSVEGS
VQNGLPRSRTGNSEGHARSRRAYLAYRERQYNPPQPDSSDAGSTLPKSGRNFEKPISTSS
KKDALRKPTEELESQQKSY
Download sequence
Identical sequences ENSOPRP00000010322 ENSOPRP00000010322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]