SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010474 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010474
Domain Number 1 Region: 111-183
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.28e-17
Family Complement control module/SCR domain 0.00028
Further Details:      
 
Domain Number 2 Region: 172-245
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.64e-17
Family Complement control module/SCR domain 0.00023
Further Details:      
 
Domain Number 3 Region: 234-299
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000202
Family Complement control module/SCR domain 0.00088
Further Details:      
 
Domain Number 4 Region: 49-115
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000564
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 5 Region: 299-367
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000367
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 6 Region: 363-430
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000249
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 7 Region: 424-460
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000125
Family Complement control module/SCR domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010474   Gene: ENSOPRG00000011485   Transcript: ENSOPRT00000011480
Sequence length 462
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3444:330275:351590:1 gene:ENSOPRG00000011485 transcript:ENSOPRT00000011480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCIARALNGTHRKKREMATWPFSGYWRVLDQTLFQVILVTVLLAPVTGDCDPPPYLSFAS
PINELHKTEYRTGESVRYTCRPGYGRASSKQYLTCTSRGLWEYDTFCIKKRCRNPGDLPN
GQVEVKTDFSFGSQIEFSCSEGYFLIGSSSSYCDIQEKGVEWSDPLPKCEIVKCESPPNI
NNGKHNGENENFFTFGSIITYTCDPDFTLLGEASISCTIQNQTVGTWSSDPPTCKKIICP
QPDVPNGKIISGFRPIYRYKDSVMFDCKDGFDLINSSLIQCEKDSSWSPSPPVCKPNSCI
GLPNIPNAYLWTQNLKQEPVYSVGKTLSYWCRSGYKPATNEPLLVTCLEDFTWSPSAGCE
EICCSPPQLENSEIVEHRKPYQRNNCTYFYGDRVFYSCPQKARSSVTCQADGRWQPPTPS
CSLSCDIPPSIAHGNHRSSYFITKEVEYECEEGYRLVGAKKL
Download sequence
Identical sequences ENSOPRP00000010474 ENSOPRP00000010474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]