SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010547 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010547
Domain Number 1 Region: 1661-1905
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.14e-53
Family Ankyrin repeat 0.0000000553
Further Details:      
 
Domain Number 2 Region: 404-447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000547
Family EGF-type module 0.00053
Further Details:      
 
Domain Number 3 Region: 240-408
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000447
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 706-747
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000479
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 5 Region: 442-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000547
Family EGF-type module 0.0012
Further Details:      
 
Domain Number 6 Region: 734-864
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000957
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 480-522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000134
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 8 Region: 93-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000356
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 9 Region: 830-940
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000141
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 10 Region: 936-979
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000026
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 11 Region: 129-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000274
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 12 Region: 974-1010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000111
Family EGF-type module 0.005
Further Details:      
 
Domain Number 13 Region: 171-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000182
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 14 Region: 517-559
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000213
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 15 Region: 209-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000428
Family EGF-type module 0.022
Further Details:      
 
Domain Number 16 Region: 668-705
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000547
Family EGF-type module 0.011
Further Details:      
 
Domain Number 17 Region: 57-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000693
Family EGF-type module 0.013
Further Details:      
 
Domain Number 18 Region: 1323-1355
Classification Level Classification E-value
Superfamily Notch domain 0.0000000994
Family Notch domain 0.0038
Further Details:      
 
Domain Number 19 Region: 1283-1316
Classification Level Classification E-value
Superfamily Notch domain 0.000000115
Family Notch domain 0.0052
Further Details:      
 
Domain Number 20 Region: 555-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000354
Family EGF-type module 0.019
Further Details:      
 
Domain Number 21 Region: 1140-1180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family EGF-type module 0.016
Further Details:      
 
Domain Number 22 Region: 1242-1274
Classification Level Classification E-value
Superfamily Notch domain 0.00000248
Family Notch domain 0.00021
Further Details:      
 
Domain Number 23 Region: 13-55
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000114
Family EGF-type module 0.014
Further Details:      
 
Domain Number 24 Region: 633-665
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000317
Family EGF-type module 0.0085
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000010547
Domain Number - Region: 1185-1222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000894
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010547   Gene: ENSOPRG00000011529   Transcript: ENSOPRT00000011557
Sequence length 2334
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2870:4979:23341:-1 gene:ENSOPRG00000011529 transcript:ENSOPRT00000011557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSGAFVGPRCQDPSPCLSSPCRNSETCVVEHVGAVDYTCTCPLGFSGPLCLTPLDHACVT
NPCRNGGTCDLLTLSEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEASYICRCLS
GFHGPTCRQDVNECTQTPGLCRHGGTCHNLVGSFRCACRPTHTGRRCELPFVPCSPSPCQ
NGGTCHPTGDTTYECACLSGFTGQNCEGNVDDCPAHSCKNGGACVDGVNTYNCRCPPEWT
GQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGA
TCHDRVASFYCECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPA
CSQDVDECALGANPCEHAGRCINTLGSFECQCLQGYTGPRCELDVNECVSNPCQNDATCL
DQIGEFQCICMPGYEGVYCEVNTDECASSPCLHNGRCLDKTNEFLCECPTGFSGHLCQYD
VDECASTPCRNGAKCLDGPNTYTCVCAEGYTGTHCEVDIDECVPDPCHYGTCKDGVATFT
CLCQPGYTGHHCETNINECYSQPCRHGGTCQDRDNAYFCFCLKGTTXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXRLCRIHIVECGRRPWRNGGTCEDGINTFPCRFPEGY
HGPPCLSEVKECNSSPCVHGVCKDSLNGYMCDCAPGWSGTNCDVNNNECESNPCVNGGTC
RDMTSGYVCTCREGFSGSNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEG
VLAPCAPGPCRNAGKCQESEDYESFSCVCPQGWQAGQTCEVDINECVKNPCLHGASCQNT
RGGYHCLCRPGYTGHNCETNVDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGTFCEEDIN
ECASNPCRHGANCTDCVDSYTCTCPAGFNGIHCEHNVPDCTESSCFNGGTCVDGINSFAC
LCPAGFTGNYCQYNINECDSRPCLHGGTCQDSYGTYKCTWPQGYTGPNCKXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGFEGATC
ENDARSCGSLRCLHGGTCVSGPRSPTCLCLASFTGPQCQFPASSPCVGSNPCYNQSCEPT
AESPFFRCLCPPKFNGLLCHILDYSFAGGAGRDIPPPVIEEACELPECREDAGNKVCSLP
CNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGRCDAQCNTPGCLFDGFDCQGVEG
HCNPLYEQYCQDHFSDGHCDQGCNSAECEWDGLDCADHVPERLAAGTLVVVVLLPPEQLR
NSSFHFLRELSRLLHTNVVFKRDAQGQRMIFPYYGREEELRKHLVKRAAAEGWAAPGSLL
GRVLPGSGAERRRRELDPMDVRGSIVYLEIDNRQCVQSSVQCFQSATDVAAFLGALASLG
NLNIPYKIEAVQSKTVEPPPPSQPHLMYVAAAAFLLLFFLGCGVLLSRKRRRQHGQLWFP
EGFKVSEASKKRREPLGEDSVGLKPLKNASDGALMDDNQNEWGDEDLETKKFRFEEPVVL
PELDGQTDHRQWTQQHLDAADLRVSAMAPTPPQGEVDADCMDVNVRGPDGFTPLMIASCS
GGGLETGNSEDEDDAPGVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEAS
ADANIQDNTGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGML
EDLINSHADVNAVDDLGKSALHWAAAVNNVDAAIVLLKNGANKDMQNHKEETPLFLAARE
GSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEYNLMRSPPLHGPALGG
TPTLSPPLCSPGGYLGNLKPAVPGKKARKPSTKGLACGGKDPKDLKARRKKSQDGKGCLL
DTSSMLSPVDSLESPHGYLSDVASPPLLPSPFRQSPSVPLNHLPGMPDTHLGLSHLSVAT
KPEMAALGGGGGRLPFEPGPPRLSHLPVASGSGTVLGASGVGGAVNFAVGGAAGLNGQCE
WLSRLQNGMVPNQYNPLHGSAAAGGLSTQAPALQHGVMGPLHSGVSANTLSQMVSYQALP
GTRLAAQPPLVPTQQVTPQNLQLQPPQGLQTAPQAHLGVGSAASSHLSRSFLGSEQSQAD
AQPLGPSGLPVHTILSPEGQALPTSLPSSLAPPMTTAQFLTPPSQHSCSSSPVDNTPSHQ
LQVPEHPFLTPSPESPDQWSSSSPHSNISDWSEGVSSPPTSMQPPLAHIPDAFK
Download sequence
Identical sequences ENSOPRP00000010547 ENSOPRP00000010547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]