SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010591 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000010591
Domain Number - Region: 171-254
Classification Level Classification E-value
Superfamily Tropomyosin 0.0124
Family Tropomyosin 0.01
Further Details:      
 
Domain Number - Region: 149-179
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 0.0576
Family Ribosomal protein L29 (L29p) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010591   Gene: ENSOPRG00000011617   Transcript: ENSOPRT00000011609
Sequence length 324
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3872:7744:11744:-1 gene:ENSOPRG00000011617 transcript:ENSOPRT00000011609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLSQQLEAKEQELQELVRQPQRDQDKEVLLLRRSVAEKERAQAASHLLCRSLANETHQLR
RTLAATAHMCQHLARRLDELQHAQGHTVDTREQSCDKXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXVEDLNAKWQRYDASRDEYVQGLQAQLQGLQAPGEPALLRKEIARLNMQLEEKI
CACTEVQRQLAAARTAQEAALEQVQVLEQQILAYKDDFRSERADRERAHSRIGELEEEVT
SLLGQLARVQDSREPGSCRLRLRSKAAQYLETDASEPAAPSGWRPGAGPNAAPGAEGDLQ
CPHCLRCFGEQGQELLQHMAECCQ
Download sequence
Identical sequences ENSOPRP00000010591 ENSOPRP00000010591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]