SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010592 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010592
Domain Number 1 Region: 856-1132
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000043
Family Rhodopsin-like 0.011
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000010592
Domain Number - Region: 478-517
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0068
Family Hormone receptor domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010592   Gene: ENSOPRG00000011604   Transcript: ENSOPRT00000011610
Sequence length 1219
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_382:3399:23345:-1 gene:ENSOPRG00000011604 transcript:ENSOPRT00000011610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLAAVLWSLCVTAVLVTSATQGLSRAGLPFGLMRRELACEGYPIELRCPGSDVIMVEN
ANYGRTDDKICDADPFQMENVQCYLPDAFKIMSQRCNNRTQCVVVAGSDAFPDPCPGTYK
YLEVQYDCVPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPATSPPLSTTTTARPT
PLTSTASPAATTPLRRAPLTTHPVGAINQLGPDLPPATAPVPSTRRPPAPNLHVSPELFC
EPREVRRVQWPATQQGMLVERPCPKGTRGIASFQCLPALGLWNPRGPDLSNCTSPWVNQV
AQKIKSGENAANIASELARHTRGSIYAGDVSSSVKLMEQLLDILDAQLQALRPIERESAG
KNYNKMHKRERTCKDYIKAVVETVDNLLRPEALESWKDMNATEQVHTATMLLDVLEEGAF
LLADNVREPARFLAAKQNVVLEVTVLNTEGQVQELVFPQEYPSENSIQLSANTIKQNSRN
GVVKVVFILYNNLGLFLSTENATVKLAGEAGTGGPGGASLVVNSQVIAASINKESSRVFL
MDPVIFTMAHLEAKNHFNANCSFWNYSERSMLGYWSTQGCRLVESNKTHTTCACSHLTNF
AVLMAHREIYQGRINELLLSVITWVGIVISLVCLAICISTFCFLRGLQTDRNTIHKNLCI
NLFLAELLFLVGIDKTQYEIACPIFAGLLHYFFLAAFSWLCLEGVHLYLLLVEVFESEYS
RTKYYYVGGYCFPALVVGIAAAIDYRSYGTEKACWLRVDNYFIWSFIGPVSFVIVVNLVF
LMVTLHKMIRSSSVLKPDSSRLDNIKSWALGAIALLFLLGLTWAFGLLFINKESVVMAYL
FTTFNAFQGVFIFVFHCALQKKVHKEYSKCLRHSYCCIRSPPGGAHGSLKTSAMRSNTRY
YTGTQSRIRRMWNDTVRKQTESSFMAGDINSTPTLNRGTMGNHLLSNPVLQRGGTSPYNT
LIAESVGFNPSSPPVFNSP
Download sequence
Identical sequences ENSOPRP00000010592 ENSOPRP00000010592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]