SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010602 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010602
Domain Number 1 Region: 106-180
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.34e-27
Family Nuclear receptor 0.0000185
Further Details:      
 
Domain Number 2 Region: 361-436
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-20
Family Nuclear receptor ligand-binding domain 0.00000874
Further Details:      
 
Domain Number 3 Region: 161-171,212-268
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0000000000302
Family Nuclear receptor ligand-binding domain 0.0000713
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010602   Gene: ENSOPRG00000011627   Transcript: ENSOPRT00000011621
Sequence length 439
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4888:8623:184137:-1 gene:ENSOPRG00000011627 transcript:ENSOPRT00000011621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLCRMSNKDRHIDPSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGL
DSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYH
YGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNKIVSHLLVAEPEKIYAMPDPTVPD
SDIKALTTLCDLADRELVVIIGWAKHIPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS
MHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIK
LEGKVPMHKLFLEMLEAKV
Download sequence
Identical sequences ENSOPRP00000010602 ENSOPRP00000010602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]