SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010675 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010675
Domain Number 1 Region: 475-578
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000011
Family Anti-sigma factor antagonist SpoIIaa 0.021
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000010675
Domain Number - Region: 35-136
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0562
Family Amylase, catalytic domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010675   Gene: ENSOPRG00000011688   Transcript: ENSOPRT00000011701
Sequence length 603
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4170:9898:20112:1 gene:ENSOPRG00000011688 transcript:ENSOPRT00000011701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPWWVKAVGRGRPPGPGMASPTCCRPALSRRLPVLAWLPRYSVQWLRLDVIAGLSVGLTV
IPQALAYAEVAGLPPQYGLYSAFTGCFVYFFLGTSRDVTLGPTAIMSLLVSLYTFREPAY
AVLLAFLSGCIQLAMGFLCLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXVGDAVLGLLCVLLLLALKLMRTHLHPLHPETPPRVRLSHGLVWT
VTTARNALVVTFAALVAYSFEVTGHQPFILTGETAQGLPPVRLPPFSVVTANRTVSFAEM
VQDMGAGMAVVPLVGLLESVAVAKAFXXXXXXXXXXXXXXXXXXFTNVLGSFVSSFPVTG
SFGRTAVNAQSGVRTPAGGLVTGMLVLLSLGYLTSLFYYTPKSALAAVIIMAVTPLFDIR
NFETGCVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSEEPVLVL
QPASGLHFPAVEALREAVLSRALEVSPPRGAILDCTHVCSVDYTMVLGLGELLGDFHRQG
VSLVFVGLQVPVLRVLLAADLKEFHHFSSMEEAEKFLRQDSGPQRYNSSEDSVPEHEVSL
LKA
Download sequence
Identical sequences ENSOPRP00000010675 ENSOPRP00000010675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]