SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010690 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010690
Domain Number 1 Region: 51-243
Classification Level Classification E-value
Superfamily vWA-like 4.87e-52
Family Integrin A (or I) domain 0.00036
Further Details:      
 
Domain Number 2 Region: 247-370
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000141
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 372-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000147
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 423-457
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00000353
Family Chicken cartilage matrix protein 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010690   Gene: ENSOPRG00000011704   Transcript: ENSOPRT00000011718
Sequence length 466
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1509:485620:505315:-1 gene:ENSOPRG00000011704 transcript:ENSOPRT00000011718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLPVSSRCSGHFLLLLLLPPLPSAPGPLTQSGSRRLGTRGPAGSPAPAASPPRTAGVCK
SRPLDLVFIIDSSRSVRPEEFTKVKTFVSRIIDTLDIGETETRVAVVNYASTVKIEFQLQ
THSDKQSLKQAVARITPLSTGTMSGLAITAMEEFTVQAGARGPAPNIPKVAIIVTDGRPQ
DQVNEVAARARASGIELYAVGVDRADRESLRMMASKPLEEHVFYVETYGVIEKLSSRFQK
TFCAVDPCVLGTHQCQHVCISDGEGRHHCECSQGYTLNADRKTCSAIDKCARNTHGCEHI
CVNDRTGSYHCECYNGYTLNADRKTCSAQDKCAAGTHGCQHLCVNDRDGSHHCECYEGYT
LNADKKTCSVQDKCALGTHGCQHVCVSDGTASYRCECFPGYSLNEDQKTCSAVEEVRSPI
SMEDACGCEATVAFQEKVSSYLQRLNTKLDGILEKLQGNEYGQMHR
Download sequence
Identical sequences ENSOPRP00000010690 ENSOPRP00000010690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]