SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010764 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010764
Domain Number 1 Region: 261-315
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000475
Family GDI-like N domain 0.00013
Further Details:      
 
Domain Number 2 Region: 526-559
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000255
Family GDI-like 0.0006
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000010764
Domain Number - Region: 390-448,560-612
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000375
Family GDI-like N domain 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010764   Gene: ENSOPRG00000011785   Transcript: ENSOPRT00000011796
Sequence length 653
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4804:4022:130187:-1 gene:ENSOPRG00000011785 transcript:ENSOPRT00000011796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADNLPSEFDVIVIGTXXXXXXXXXXXXXXXXXXXXXXXRSYYGGNWASFSFSGLLSWIK
ENQENNDTANESSPWQEHVLENEEAIALSQKDKTIQHVEVFCYAXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXTRILAFREGRVEQVPCSRADVFNSKQLSMVEKRMLMKFLT
FCLEYEEHPDEYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXMCAVFGGIYCLRHPVQCLVVDKESRECKAVI
DQFGQRINCKHFLVEDSYLSENICARVQYRQNCRPALITDRSELKTKSDXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLFTPYSEMEIEKEE
VEKPRILWALYFNMRDSSDISRNCYNDLPPNVYVCSGPDAALGNDNAVKQAQTIFQQIYP
NEDFCPPPPNPEDIVLDGETSQPEASESIPKSEGNSETPEESANPEDPLAPSE
Download sequence
Identical sequences ENSOPRP00000010764 ENSOPRP00000010764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]