SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010834 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010834
Domain Number 1 Region: 1464-1569
Classification Level Classification E-value
Superfamily C-type lectin-like 1.39e-42
Family Noncollagenous (NC1) domain of collagen IV 0.00000479
Further Details:      
 
Domain Number 2 Region: 1570-1682
Classification Level Classification E-value
Superfamily C-type lectin-like 5.65e-40
Family Noncollagenous (NC1) domain of collagen IV 0.00000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010834   Gene: ENSOPRG00000011816   Transcript: ENSOPRT00000011871
Sequence length 1684
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_823:94543:210701:-1 gene:ENSOPRG00000011816 transcript:ENSOPRT00000011871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLIMKKLWLLLTTLCLTQELTRAGEKNFHGRPCGGQDCSGGCQCLPEKGARXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGHPGQPGPRG
PPGLDGCNGTQGAVGIPGPDGFPGLHGPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLFPHYKDEKSLLGDVGPPGPAGPPPSTG
ELEFMGLPKGKKGSKXXXXXXXXXXXXXXXXXXGFGTTGEKGEKGIPGLPRPRXXXXXXX
XXXXXXXXXXXXKKGSPGFPGLNGLPGIKGEKGGIGLPGSDIFIDVNGAIISXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXIQGTLGPQGFSGLKGDQGNPGHTTTGPAGLP
GKDGLPGLPGPRGPPGPLLGTGTLHRTEPGFPGLRGVQGPKGNPGLKGVKGDAGFCVCDG
GISNTGAPGEPGQRGPQGLMGPPGIKGIRGDPGAGGTQGPGGTPGLLGPTGPPGSKGEKG
EATLHTQSGMPGEKGDPGPQGFPGVAGAQGKDGTTGLPGVPGLPGDGGQGFLGEKGFPGQ
PGEKGHRGPTGLPGIGLPGLPGPRGVPGEQGRDGLPGKQGPPGSPGITLPCITSELYGPS
GSPGAPGFPGPKGARGLPGTPGQPGLRGSKGTPGNPGLVHLPEMPGXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXGTPGLTGRLGSPGLPGSTGMPGLVGPKGETGSIGPVG
FPGIPGLPGIPGASGLKGTSGSPGKLGPFGQPGIPGEKGHRGDPGPAGTSSSRFPTLNVL
FKGDKGTQGSAGSNGFPGLRGDKGEIGLPGLPGLPGTRGLSSTIKGLTGNPGPSGPTGLP
GLPGLKGSRGIMGFPGMPGEGGPQGLNGIPGLTGAPGPLGSKGDQGQTFKVSGNPGPKGK
AGESGIKGQKGENGPAGDMGLTGSQGENGETGVVGDIGLPGPPGLPGITGLRGDPGLPGF
SGLPGVAGPLGSSGIIGPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPQGPKGDQGIPGFSGLPGELGLRGM
RGEPGFMGIPGKVGPPGDPGFPGMKGKAGPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXSKGLPGIPGKDGSNGLPGPPGALGDPGLPGPQGPAGFEG
APGKQGPLGRPGVADQSVRVGYTLVKHSQSEQVPPCPVGMSQLWVGYSLLFVEGQEKAHN
QDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVGQSQIPQYIS
RCSVCEAPSQAIAVHSQDTTIPQPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLED
FRATPFIECSGVRGTCHYFANKYSFWLSTVEERQQFREEPVSETLKAGQLHTRVSRCQVC
MKSL
Download sequence
Identical sequences ENSOPRP00000010834 ENSOPRP00000010834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]