SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010894 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010894
Domain Number 1 Region: 92-150
Classification Level Classification E-value
Superfamily Leucine zipper domain 1.19e-20
Family Leucine zipper domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010894   Gene: ENSOPRG00000011952   Transcript: ENSOPRT00000011939
Sequence length 296
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3524:650616:656592:1 gene:ENSOPRG00000011952 transcript:ENSOPRT00000011939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGH
MALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQA
ETEELEEEKSGLQKEIAELQKEKERLEFMLVAHGPVCKVSPEERRSPPTTGLPPMRGGSG
SGGGAVGAVVVKQEPLEEDSPSSSAAGLDKGQRSVIKPISIAGAFYGEEPLHTPIVVTST
PAITPGTSNLVFTYPNVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL
Download sequence
Identical sequences ENSOPRP00000010894 ENSOPRP00000010894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]