SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010910 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010910
Domain Number 1 Region: 338-564
Classification Level Classification E-value
Superfamily vWA-like 2.07e-59
Family Integrin A (or I) domain 0.00033
Further Details:      
 
Domain Number 2 Region: 11-214
Classification Level Classification E-value
Superfamily vWA-like 3.67e-54
Family Integrin A (or I) domain 0.00026
Further Details:      
 
Domain Number 3 Region: 214-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000583
Family EGF-type module 0.02
Further Details:      
 
Domain Number 4 Region: 574-613
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00000000366
Family Chicken cartilage matrix protein 0.0023
Further Details:      
 
Domain Number 5 Region: 291-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000726
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010910   Gene: ENSOPRG00000011944   Transcript: ENSOPRT00000011956
Sequence length 614
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3866:431366:441689:-1 gene:ENSOPRG00000011944 transcript:ENSOPRT00000011956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLACSLLLLLLQAWESQPQAAGPKCHTGPLDLVFVIDSSRSVRPFEFETVRQFLVGLL
RSLDVGLNATRVGVIQYSSQVQSVFPLGAFSRREDMERALRALVPLAQGTMTGLAIQYAM
NVAFSVAEGARPPEQRVPRVAVIVTDGRPQDRVAEVAAQARARGIEIYAVGVQRADVGSL
RAMASPPLEEHVFVVETFDLIQEFGRQLHGRLCGTDLCAEGRHGCQHRCVNARGAFHCTC
NPGYQLAADNRSCVVVDLCAGAVHGYNHPVTFPAAHFCRYAGLVPPQHRGCRAVDHCSWG
NHSCQHECVSTLQGPRCRCREGHDLLPDGRSCHIRDLCNGVDHGCEFECVSEGLTYRCLC
PEDWQLQADGKSCTRCREGHVDLVLLVDGSKSVRPQNFELVKRFVNQIVDFLDVSPEGTR
VGLVQFSSRVRTEFPLGRYGTAAEIKQAVLAVEYMERGTMTGLALRHMVEHSFSEAQGAR
PRALHVPRVGLVFTDGRSQDDISVWAARAKEEGIVMYAVGVGKAVEEELRTIASEPAELH
VSYSPDFNTMTHLLENLKGSICPEEGIGAGTELRSPCDCESLVEFQGRTLGTLDSLTQKL
AQLSVRLENLENVL
Download sequence
Identical sequences ENSOPRP00000010910 ENSOPRP00000010910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]