SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010938 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000010938
Domain Number - Region: 2-58
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0677
Family Rhodopsin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010938   Gene: ENSOPRG00000011999   Transcript: ENSOPRT00000011988
Sequence length 124
Comment pep:novel genescaffold:pika:GeneScaffold_5137:473058:474393:1 gene:ENSOPRG00000011999 transcript:ENSOPRT00000011988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPACNENMKFYLYVGLGLTGLLLLAMVILSACLCRLHRRVKQLARSWPSCQQSQSCTTRL
CRGCLCKVQRVLTLAMEKKKASRRTPVLTTPASLKASPPEHSLIPLGHLPHPQQVSRATL
RFSQ
Download sequence
Identical sequences ENSOPRP00000010938 ENSOPRP00000010938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]