SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010979 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010979
Domain Number 1 Region: 4-157
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.46e-43
Family Rhodopsin-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010979   Gene: ENSOPRG00000012045   Transcript: ENSOPRT00000012029
Sequence length 158
Comment pep:novel scaffold:pika:scaffold_10954:61684:62157:-1 gene:ENSOPRG00000012045 transcript:ENSOPRT00000012029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTLRNQTQLSEFLLLGFSEDSALQPLIFGLFLSMYLVTVSGNLLIVLAILSDPHLHTPMY
FFLTNLSLVDICFTSTAISKSLVNIKRQSRAISYTGCLTQMFFFLLFGSLDNFLLTEMAY
NHYVAICHALHYMGIMNSWLCVQLVLVCWGIDVLNAML
Download sequence
Identical sequences ENSOPRP00000010979 ENSOPRP00000010979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]