SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011053 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011053
Domain Number 1 Region: 356-540
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.02e-43
Family Nuclear receptor ligand-binding domain 0.00012
Further Details:      
 
Domain Number 2 Region: 121-210
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-29
Family Nuclear receptor 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011053   Gene: ENSOPRG00000012121   Transcript: ENSOPRT00000012109
Sequence length 541
Comment pep:known_by_projection scaffold:pika:scaffold_13961:39273:42357:-1 gene:ENSOPRG00000012121 transcript:ENSOPRT00000012109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVITYIGSSSSSPSRTSPESLYSDSSNGSFQSLPHSCPTYLPPSPTGSLTQDPARSFGSI
PANLGDDGSPSSSSSSSSSTSSSSSFYNGSPSGSLQVAMEDSSRVSPSKSTSNITKLNGM
VLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQQC
RFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLENSPMQHPTPG
PMGPSPPPPAAVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTYAHDKL
GTSPGNFNANQAVGSPPATTPHRWENQGCPPAPNDNNALAAQRHNEALNGLRQTPSSYPP
TWPPSPAHHSCHQPNSNGHRLCPTHMYAAPEGEAPANTPRQGNSKNVLLACPMNMYPHGR
SGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRFASL
FNVKDQTVMFLSRTTYSLQELGAMGMGDLLNAMFDFSEKLNSLALTEEELGLFTAVVLVS
A
Download sequence
Identical sequences ENSOPRP00000011053 ENSOPRP00000011053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]