SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011144 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011144
Domain Number 1 Region: 129-405
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.54e-38
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000911
Further Details:      
 
Domain Number 2 Region: 397-544
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.02e-28
Family Ricin B-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011144   Gene: ENSOPRG00000012198   Transcript: ENSOPRT00000012212
Sequence length 547
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3254:91222:291056:-1 gene:ENSOPRG00000012198 transcript:ENSOPRT00000012212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLTRRLALPLFGVLITELLIFWFNKSNLKAPPEAEVQPPKIGSLPFRQGGMGIWAHQG
PVCPPFLGHLPPHTHLRVYRRAQLLLLTQIFLKIXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXILNRTPLHLIQEIILVDDFSNDPEDCNQLVKLPKVKCLRNNERQGLVRSRIR
GADIAQGTTLTFLDSHCEVNRDWLQPLLHRIKEDYTRVVCPVIDIINLDTFNYIESASEL
RGGFDWSLHFQWEQLSPEQKARRLDPTEPIRTPVIAGGLFVIDKAWFDYLGKYDVDMDIW
GGENFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTKRTAEVWMDE
YKQYYYAARPFALERPFGSIQNRVLLRNSLQCQSFKWYLENVYPELRIPNDSSIQKGSIR
QRQRCLESQRPSNQENPNLKLSPCSKSTGEKAKSQIWAFTYTQQIIQEELCLSVVTLFPG
APVVLVLCKNGDDKQQWTKTGSHIEHIASHLCLDTDMFGDSTEAGTDVVVNPCESSLMSQ
HWDMMSS
Download sequence
Identical sequences ENSOPRP00000011144 ENSOPRP00000011144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]