SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011183 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011183
Domain Number 1 Region: 28-191
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.29e-45
Family Proteasome subunits 0.0000000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011183   Gene: ENSOPRG00000012259   Transcript: ENSOPRT00000012254
Sequence length 192
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1123:119405:147382:-1 gene:ENSOPRG00000012259 transcript:ENSOPRT00000012254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCLPPRCCLTGEARVLCTCSPQPTATMEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDK
MFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRS
RTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRD
KAVELLKKCLEE
Download sequence
Identical sequences ENSOPRP00000011183 ENSOPRP00000011183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]