SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011261 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011261
Domain Number 1 Region: 213-345
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-32
Family C-type lectin domain 0.00066
Further Details:      
 
Domain Number 2 Region: 351-488
Classification Level Classification E-value
Superfamily C-type lectin-like 6.47e-31
Family C-type lectin domain 0.0005
Further Details:      
 
Domain Number 3 Region: 1083-1201
Classification Level Classification E-value
Superfamily C-type lectin-like 3.04e-27
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 4 Region: 1346-1491
Classification Level Classification E-value
Superfamily C-type lectin-like 5.47e-27
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 5 Region: 33-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 9.19e-25
Family Cysteine rich domain 0.0051
Further Details:      
 
Domain Number 6 Region: 1214-1339
Classification Level Classification E-value
Superfamily C-type lectin-like 1.31e-20
Family C-type lectin domain 0.003
Further Details:      
 
Domain Number 7 Region: 498-624
Classification Level Classification E-value
Superfamily C-type lectin-like 9.1e-19
Family C-type lectin domain 0.0021
Further Details:      
 
Domain Number 8 Region: 1514-1582
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000997
Family C-type lectin domain 0.0024
Further Details:      
 
Domain Number 9 Region: 635-711
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000265
Family C-type lectin domain 0.0037
Further Details:      
 
Domain Number 10 Region: 799-909
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000013
Family C-type lectin domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011261   Gene: ENSOPRG00000012326   Transcript: ENSOPRT00000012340
Sequence length 1698
Comment pep:novel genescaffold:pika:GeneScaffold_2276:82786:174027:-1 gene:ENSOPRG00000012326 transcript:ENSOPRT00000012340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKARPATPGRAVGLLTLLIPCLGLAEPSSHSGNDPFTIVHENTGKCIQALDDWIVTKDCN
GTRDMLWKWVSKHRLFHLQSQKCLGLNITKQKDSLKMFSCDSPAMLWWKCEHHSLYGAAQ
YKLAVEDGHAIASTNASDVYKKGGSSEGLCDQPYHXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNGCEENWEKNEQTGSCYQFNNPATLSW
KEAYLACHSQGADLLSISNATELTYLKEKEDIAKFFWIGLNQLHSARGWEWSDHKPLNFL
NWDPDKFNTPALGGSSCVRMNAESGLWESLPCEALLPYVCKKPLNNSMELTDDWTYSDTR
CDADWLPNNGFCYWLGNESDSWDNARMKCKALSSDLLSIHSLADVEVVVTKLHNGDAKEE
IWTGLKNINVPTLFQWSDGSEVTLTYWDENEPNIPYNNTPSCVSYSGKLGQWKVQPCEKK
LNYTCKKKGEKINDPGSGKICPPEEGWKRHGEACYKIYKDEVPFGKNCNLTITSRFEQEF
LNDMMKKYDKSLTKYFWTGLIDVDSHGEYSWASAGGIKRAVTFANWNFLEPAFPGGCVAM
STGKSLGKWEVKDCKNFRALSICKNVSGPVEPEEPAPKPSDPCPDGWHSFANSLSCYKAF
HIERVVRKRNWEEAERFCQSLGAHLVSFGHVDEMKEFLHWLTEQFSDNRWXXXXXXXXXX
XXXXXXXXXXXXXVTHRPWRRSWYFFDDYDFFYMRPFACDTKLEWVCHIPKGRTPKAPEW
YNPXXXXXXXXXXXXXXXEYWFVAEPHLNYEEAFLYCATNYSFLATVTSFTGLKAIRNKI
ANISSDEQKWWLRANEQPIXXXXXXFRRPWYYYPFEFGEECMYMSAKTWLIDLNKPADCN
TKLPFICEKHSVSPLEKYSPDPTAKVQCSEKWVSFGNKXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXIFEEDSQYHCAVILNHPKSPFTGTWNFTSCNEYHPVSLCQXXXXIQSNQSVQN
ASETVKYKNNLYKIILKRLTWYQAVEECMKNSMQLVSITDPYQQAFLTVQAAQQNSSLWI
GLSSQDDELNFGWSDGRRLEFTRWDENHHHLEDCVFLEKNGFWRTADCETSLPGAICYYP
GNDTKEEIKPVANVECPSPVLSTPWIPFQNCCYNFMITKNRHMATTPEEAHSKCQQLNPK
SHMLSIRDEEENNFVLEQLLRLHYMASWVLLGLTYEGNSLTWFDKTTLSYTHWRGGRPAV
QNGKFWAGLNTDGFWDIQPFNMEETIYFQQHSIVVCKIEMVDYKEEYNTTLPEFIPYEDN
IYNVIQKRVTWYEALKACSEGRGQLASVHDQNGQLFLEDIAKRDGFPLWVGLSSHDGSES
SFEWSDGSAFDYIPWKGEKGPGDCVVLDPKGNWKHEKCSSSVDGAICYKPTKPKELTSYS
HSSRCPEAKENGTQWMQYKGHCYASDRALHSFSEAKYLCSELDHSSTIVTIKDEDENQFV
SQLIRENNNITMRVWLGLSQHSIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXSDYKGVAIGFAVLSVLVLISGLIWFLFQRNRFQWAGFSSV
RYEQGVSEEEIVLPSFQD
Download sequence
Identical sequences ENSOPRP00000011261 ENSOPRP00000011261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]