SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011278 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011278
Domain Number 1 Region: 99-113,221-353,392-473
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.45e-41
Family Nuclear receptor ligand-binding domain 0.00000000939
Further Details:      
 
Domain Number 2 Region: 30-115
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.36e-32
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011278   Gene: ENSOPRG00000012364   Transcript: ENSOPRT00000012358
Sequence length 483
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4518:254047:319551:-1 gene:ENSOPRG00000012364 transcript:ENSOPRT00000012358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSWRDNVKATKSPKADEDTQIEGVSAQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS
QQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEV
QKHRLQQQQRDHPQQPGEAEPLTPTYNISANGLTELHDDLSSYMDGHTPEGSKADSAVSS
FYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNI
SKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKR
IDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNSVYFDGKYASPEVFKSLXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSWLQEKVKIEKLQQKIQLALQHVLQKN
HREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQ
IDG
Download sequence
Identical sequences ENSOPRP00000011278 ENSOPRP00000011278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]